Member Site › Forums › ROSIE › ROSIE – General › Antibody prediction with ROSIE failed
- This topic has 4 replies, 3 voices, and was last updated 5 years, 7 months ago by Anonymous.
-
AuthorPosts
-
-
August 3, 2017 at 6:45 am #2709Anonymous
Dear all,
I submitted the sequeces for the variable regions of the heavy and light chains of a antibody to ROSIE in order to predict the 3d structures. However when the job finished there seemed no structure output. The following is the output message:
Antibody script failed with message: Rosetta Antibody script [Python, version 2.0]. Starting...
Could not find output/details/... creating it...
Output prefix: output/
Blast database: /home/rosie/rosie/rosie.back/data/antibody/scripts/blast_database
Antibody database: /home/rosie/rosie/rosie.back/data/antibody/scripts/antibody_database
rosetta_bin: /home/rosie/rosie/rosie.back/data/antibody/bin [platform: static.linuxgccrelease]
rosetta_database: /home/rosie/rosie/rosie.back/data/antibody/rosetta_database
Using full antibody database (no homolog exclusion)
Idealize: False
Relax: True
Light chain: DVVMTQSPSFLSASVGDRVTITCRASQDITINLNWFQHKPGKAPKRLIYVASRLERGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYNNYPLTFGPGTKLDIKRTV
Heavy chain: EVQLVQSGGGLVQPGGSMRLSCEASGLSLSDYFMHWVRQAQGKGLEWIGLIQTKAFTYKTEYPAAVKGRFTISRDDSKNTLYLQMSSLKPEDTALYYCIAVTPDFYYWGQGVLVTVSS
L1 detected: RASQDITINLN (11 residues at positions 23 to 33)
L3 detected: QQYNNYPLT ( 9 residues at positions 88 to 96)
L2 detected: VASRLER (7 residues at positions 49 to 55)
FR_L1: DVVMTQSPSFLSASVGDRVTITC
FR_L2: WFQHKPGKAPKRLIY
FR_L3: GVPSRFSGSGSGTEFTLTISSLQPEDFATYYC
FR_L4: FGPGTKLDIKRT
L segments: DVVMTQSPSFLSASVGDRVTITC RASQDITINLN WFQHKPGKAPKRLIY VASRLER GVPSRFSGSGSGTEFTLTISSLQPEDFATYYC QQYNNYPLT FGPGTKLDIKRT
H1 detected: GLSLSDYFMH (10 residues at positions 25 to 34)
H3 detected: VTPDFYY (7 residues at positions 100 to 106)
H2 detected: LIQTKAFTYKTEYPAAVKG (19 residues at positions 49 to 67)
FR_H1: EVQLVQSGGGLVQPGGSMRLSCEAS
FR_H2: WVRQAQGKGLEWIG
FR_H3: RFTISRDDSKNTLYLQMSSLKPEDTALYYCIA
FR_H4: WGQGVLVTVSS
H segments: EVQLVQSGGGLVQPGGSMRLSCEAS GLSLSDYFMH WVRQAQGKGLEWIG LIQTKAFTYKTEYPAAVKG RFTISRDDSKNTLYLQMSSLKPEDTALYYCIA VTPDFYY WGQGVLVTVSS
Running /home/rosie/prefix/blast+/bin/blastp
I: Queryname=FRL
I: Found 600 blast results (limit 600)
Could not find output/details/filters/... creating it...
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
FRL template: pdb1dql_chothia.pdb
I: Queryname=FRH
I: Found 600 blast results (limit 600)
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
FRH template: pdb3eot_chothia.pdb
I: Queryname=light
I: Found 600 blast results (limit 600)
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
light template: pdb3uc0_chothia.pdb
I: Queryname=heavy
I: Found 600 blast results (limit 600)
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
heavy template: pdb1ad0_chothia.pdb
I: Queryname=L1
I: Found 342 blast results (limit 600)
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
L1 template: pdb1ikf_chothia.pdb
I: Queryname=L2
I: Found 70 blast results (limit 600)
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
L2 template: pdb1ai1_chothia.pdb
I: Queryname=L3
I: Found 170 blast results (limit 600)
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
L3 template: pdb2cmr_chothia.pdb
I: Queryname=H1
I: Found 22 blast results (limit 600)
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
H1 template: pdb1uj3_chothia.pdb
I: Queryname=H2
I: Found 58 blast results (limit 600)
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
H2 template: pdb2bmk_chothia.pdb
I: Queryname=H3
I: Found 0 blast results (limit 600)
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
WARNING: No template avaliable for H3 after filtering! Using a random template of the same length as the query
H3 template: pdb2xkn_chothia.pdb
I: Queryname=light_heavy
I: Found 600 blast results (limit 600)
light_heavy template: pdb1dql_chothia.pdb
light_heavy template: pdb1dee_chothia.pdb
light_heavy template: pdb1hez_chothia.pdb
light_heavy template: pdb2wuc_chothia.pdb
light_heavy template: pdb3eo9_chothia.pdb
light_heavy template: pdb3bn9_chothia.pdb
light_heavy template: pdb3k2u_chothia.pdb
light_heavy template: pdb3skj_chothia.pdb
light_heavy template: pdb1dfb_chothia.pdb
light_heavy template: pdb1jpt_chothia.pdb
Running ProFit...
profit < output/details/profit-H.in > output/details/profit-H.out sh: /bin/profit: Permission deniedCould anyone tell me why the job failed? And how at the end Running ProFit got “Permission denied” error?
Best regards
Yeping Sun
-
August 3, 2017 at 6:50 pm #13645Anonymous
Thank you for letting us know! This looks like a server error, could you please tell me the job number so we can troubleshoot it?
-
August 4, 2017 at 2:16 am #13646Anonymous
The job number is 33960
-
May 8, 2019 at 11:10 pm #14703Anonymous
Hi Sergey,
I just ran into the very same problem with job no 69652 . Has anybody placed an additional installation of profit into /bin ?
Cheers,
Steffen
-
May 9, 2019 at 3:15 pm #14704Anonymous
This shold be fixed now. Could you please try to re-submit your jobs?
-
-
AuthorPosts
- You must be logged in to reply to this topic.